• DRAMP ID

    • DRAMP00127
    • Peptide Name

    • Plantaricin F (PlnF; Bacteriocin)
    • Source

    • Lactobacillus plantarum (Gram-positive bacteria)
    • Family

    • Belongs to the class IIb bacteriocin
    • Gene

    • plnF
    • Sequence

    • VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG
    • Sequence Length

    • 34
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Pediococcus pentosaceus Pac 1.0MIC=5 nM
        Lactobacillus plantarum 965MIC=7 nM
        Lactobacillus casei subsp.casei NCDO 161MIC=20 nM
        Lactobacillus casei NCDO 2713MIC=150 nM
        Lactobacillus sakei NCDO 2714MIC=4 nM
        Lactobacillus viridescens NCDO 1655MIC=2 nM
        Pediococcus pentosaceus NCDO 990MIC=30 nM
        Lactobacillus sakei 706MIC=100 nM
        Pediococcus acidilactici CHMIC=10 nM
        Lactobacillus curvatus 89MIC=5 nM
        [PlnE:PlnF=1:1]
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • There is a possible hydrogen bond/salt bridge between Asn12/Asn13 and Asp22
    • Stereochemistry

    • L
    • PDB ID

    • 2RLW resolved by NMR.
    • Predicted Structure

    • Formula

    • C169H253N51O44
    • Absent Amino Acids

    • CELMQT
    • Common Amino Acids

    • AV
    • Mass

    • 3703.18
    • PI

    • 10.27
    • Basic Residues

    • 6
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +5
    • Boman Index

    • -40.97
    • Hydrophobicity

    • 0.035
    • Aliphatic Index

    • 80.29
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 256.97
    • Polar Residues

    • 11

DRAMP00127

DRAMP00127 chydropathy plot
    • Function

    • A strain-specific antagonistic activity was detected at nanomolar concentrations when PlnE and PlnF were combined. Complementary peptides were at least 103 times more active when they were combined than when they were present individually, and optimal activity was obtained when the complementary peptides were present in approximately equal amounts.
  • ·Literature 1
    • Title

    • The gene encoding plantaricin A, a bacteriocin from Lactobacillus plantarum C11, is located on the same transcription unit as an agr-like regulatory system.
    • Reference

    • Appl Environ Microbiol. 1994 Jan;60(1):160-166.
    • Author

    • Diep DB, Håvarstein LS, Nissen-Meyer J, Nes IF.
  • ·Literature 2
    • Title

    • Antagonistic activity of Lactobacillus plantarum C11: two new two-peptide bacteriocins, plantaricins EF and JK, and the induction factor plantaricin A.
    • Reference

    • Appl Environ Microbiol. 1998 Jun;64(6):2269-2272.
    • Author

    • Anderssen EL, Diep DB, Nes IF, Eijsink VG, Nissen-Meyer J.
  • ·Literature 3
    • Title

    • Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin plantaricin EF.
    • Reference

    • Author

    • Fimland N, Rogne P, Fimland G, Nissen-Meyer J, Kristiansen P.E.