General Information
-
DRAMP ID
- DRAMP00171
-
Peptide Name
- Lactocyclicin Q (Bacteriocin)
-
Source
- Lactococcus sp. strain QU 12 (Gram-positive bacteria)
-
Family
- Belongs to the class IIc bacteriocin
-
Gene
- lycQ
-
Sequence
- LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
-
Sequence Length
- 61
-
UniProt Entry
- B9ZZY0
-
Protein Existence
- Predicted
Activity Information
-
Biological Activity
- Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
-
Target Organism
-
- Gram-positive bacteria:
Target Organism Activity Lactococcus sp.strain QU 12 MIC=34.3 µM Lactococcus lactis subsp.lactis JCM 7638 MIC=0.141 µM L. lactis subsp.lactis ATCC 19435 MIC=0.141 µM L. lactis subsp.lactis IL1403 MIC=0.141 µM L. lactis QU 1 MIC=0.141 µM L. lactis subsp.cremoris ATCC 19275 MIC=0.283 µM Lactococcus raffinolactis JCM 5706 MIC=0.71 µM Lactobacillus sakei subsp.sakei JCM 1157 MIC=0.015 µM Lactobacillus casei subsp.casei JCM 1134 MIC=2.27 µM Leuconostoc brevis JCM 1059 MIC=1.14 µM L. acidophilus JCM 1132 MIC=2.86 µM L. coryniformis subsp.coryniformis JCM 1164 MIC=2.86 µM L. kimchii JCM 10707 MIC=0.71 µM L. mesenteroides subsp.mesenteroides JCM 6124 MIC=1.03 µM Weissella cibaria JCM 12495 MIC=0.71 µM Pediococcus pentosaceus JCM 5885 MIC=0.55 µM P. pentosaceus JCM 5890 MIC=2.86 µM P. acidilactici JCM 8797 MIC=2.86 µM P. dextrinicus JCM 5887 MIC=0.141 µM Enterococcus faecium JCM5804 MIC=0.71 µM E. hirae ATCC 10541 MIC=0.71 µM E. durans NBRC 100479 MIC=0.71 µM E. faecalis JCM 5803 MIC=0.26 µM Streptococcus salivarius JCM 5707 MIC=22.9 µM S. bovis JCM 5802 MIC=22.9 µM Bacillus coagulans JCM 2257 MIC=0.015 µM B. circulans JCM 2504 MIC=0.031 µM B. subtilis JCM 1465 MIC=0.064 µM B. cereus JCM 2152 MIC=11.4 µM Micrococcus luteus IFO 12708 MIC=5.7 µM Listeria innocua ATCC 33090 MIC=1.03 µM L. monocytogenes ATCC BAA-679 MIC=1.03 µM Staphylococcus aureus subsp.aureus ATCC 12600 (MIC=91.6 µM); Gram-negative bacteria: Escherichia coli JM109 (MIC=34.3 µM) - E. coli NBRC 3301 MIC=17.3 µM
- Gram-positive bacteria:
-
Hemolytic Activity
-
- No hemolysis information or data found in the reference(s) presented in this entry
-
Cytotoxicity
- No cytotoxicity information found in the reference(s) presented
-
Binding Target
- Not found
Structure Information
-
Linear/Cyclic
- Cyclic
-
N-terminal Modification
- Cyclization (N termini to C termini)
-
C-terminal Modification
- Cyclization (C termini to N termini)
-
Nonterminal Modifications and Unusual Amino Acids
- The whole peptide has a cyclic structure in which N and C termini are bound to each other.
-
Stereochemistry
- L
-
PDB ID
- None
-
Predicted Structure
-
- Please click DRAMP00171_predicted_structure.pdb to download.
Physicochemical Information
-
Formula
- C284H449N77O71
Absent Amino Acids
- CEFMY
Common Amino Acids
- A
Mass
- 6078.16
PI
- 9.7
Basic Residues
- 6
Acidic Residues
- 2
Hydrophobic Residues
- 38
Net Charge
- +4
-
Boman Index
- 45.98
Hydrophobicity
- 0.826
Aliphatic Index
- 126.72
Half Life
-
- Mammalian:5.5 hour
- Yeast:3 min
- E.coli:2 min
Extinction Coefficient Cystines
- 22000
Absorbance 280nm
- 366.67
Polar Residues
- 11
DRAMP00171
Comments Information
Comment
- No comments found on DRAMP database
Literature Information
- ·Literature 1
-
Title
- Identification and characterization of lactocyclicin Q, a novel cyclic bacteriocin produced by Lactococcus sp. strain QU 12.
-
Pubmed ID
- 19139222
-
Reference
- Appl Environ Microbiol. 2009 Mar;75(6):1552-1558.
-
Author
- Sawa N, Zendo T, Kiyofuji J, Fujita K, Himeno K, Nakayama J, Sonomoto K.
- ·Literature 2
-
Title
- Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401.
-
Pubmed ID
- 21948835
-
Reference
- Appl Environ Microbiol. 2011 Nov;77(22):8164-8170.
-
Author
- Masuda Y, Ono H, Kitagawa H, Ito H, Mu F, Sawa N, Zendo T, Sonomoto K.
