• DRAMP ID

    • DRAMP00173
    • Peptide Name

    • Leucocyclicin Q (Bacteriocin)
    • Source

    • Leuconostoc mesenteroides TK41401 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIc bacteriocin
    • Gene

    • lcyQ
    • Sequence

    • LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW
    • Sequence Length

    • 61
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Lactococcus lactis ssp. lactis JCM 7638MIC=0.038 µM
        L. lactis ssp. lactis ATCC 19435MIC=0.038 µM
        L. sp. QU 12MIC=1.203 µM
        Lactobacillus sakei ssp. sakei JCM 1157MIC=0.038 µM
        Weissella cibaria JCM 12495MIC=2.405 µM
        W. paramesenteroides JCM 9890MIC=0.075 µM
        Pediococcus pentosaceus JCM 5885MIC=2.405 µM
        P. dextrinicus JCM 5887MIC=0.038 µM
        Enterococcus faecium JCM 5804MIC=0.038 µM
        E. faecalis JCM 5803MIC=0.15 µM
        Streptococcus salivarius JCM 5707MIC=2.405 µM
        S. bovis JCM 5802MIC=0.601 µM
        S. mutans JCM 5705MIC=19.25 µM
        Bacillus coagulans JCM 2257MIC=0.075 µM
        B. subtilis ssp. subtilis JCM 1465MIC=0.601 µM
        B. cereus JCM 2152MIC=2.405 µM
        Kocuria rhizophila NBRC 12708MIC=9.623 µM
        Listeria innocua ATCC 33090MIC=0.601 µM
        Leuconostoc mesenteroides ssp. mes. JCM 6124MIC=0.3 µM
        Escherichia coli JM109MIC=38.49 µM
        E. coli NBRC 3301MIC=38.49 µM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Cyclization (N termini to C termini)
    • C-terminal Modification

    • Cyclization (C termini to N termini)
    • Nonterminal Modifications and Unusual Amino Acids

    • The whole peptide has a cyclic structure in which N and C termini are bound to each other.
    • Stereochemistry

    • L
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C282H460N74O77
    • Absent Amino Acids

    • CDFMRY
    • Common Amino Acids

    • A
    • Mass

    • 6119.2
    • PI

    • 9.53
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 35
    • Net Charge

    • +3
    • Boman Index

    • 35.71
    • Hydrophobicity

    • 0.751
    • Aliphatic Index

    • 129.84
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 16500
    • Absorbance 280nm

    • 275
    • Polar Residues

    • 16

DRAMP00173

DRAMP00173 chydropathy plot
    • Function

    • This precursor showed high similarity to the precursor of lactocyclicin Q, a cyclic bacteriocin produced by Lactococcus sp. strain QU 12. This is the first report of a cyclic bacteriocin produced by a strain of the genus Leuconostoc.
  • ·Literature 1
    • Title

    • Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401.
    • Reference

    • Appl Environ Microbiol. 2011 Nov;77(22):8164-8170.
    • Author

    • Masuda Y, Ono H, Kitagawa H, Ito H, Mu F, Sawa N, Zendo T, Sonomoto K.