• DRAMP ID

    • DRAMP00457
    • Peptide Name

    • Defensin-like protein 1 (LCR68; Plant defensin 2.3; Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the DEFL family
    • Gene

    • PDF2.3
    • Sequence

    • RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC
    • Sequence Length

    • 47
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00457.
    • Formula

    • C217H342N82O62S8
    • Absent Amino Acids

    • DILMQW
    • Common Amino Acids

    • C
    • Mass

    • 5348.1
    • PI

    • 9.49
    • Basic Residues

    • 14
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +12
    • Boman Index

    • -156.61
    • Hydrophobicity

    • -0.951
    • Aliphatic Index

    • 14.47
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 43.26
    • Polar Residues

    • 24

DRAMP00457

    • Tissue specificity

    • Expressed in the whole plant except roots.
    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.
  • ·Literature 1
    • Title

    • Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    • Reference

    • Plant Biotechnol J. 2006 May;4(3):317-324.
    • Author

    • Underwood BA, Vanderhaeghen R, Whitford R, Town CD, Hilson P.