• DRAMP ID

    • DRAMP00459
    • Peptide Name

    • Defensin-like protein 3 (Protein LCR71; Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the DEFL family
    • Gene

    • LCR71
    • Sequence

    • RICKSRSQKFKGPCVSEDNCANVCHTEGFPDGDCDGLLRRCYCNTHC
    • Sequence Length

    • 47
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00459.
    • Formula

    • C214H338N70O70S8
    • Absent Amino Acids

    • MW
    • Common Amino Acids

    • C
    • Mass

    • 5267.94
    • PI

    • 7.72
    • Basic Residues

    • 9
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +3
    • Boman Index

    • -130.48
    • Hydrophobicity

    • -0.704
    • Aliphatic Index

    • 39.36
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 43.26
    • Polar Residues

    • 21

DRAMP00459

    • PTM

    • Contains four disulfide bonds 3-47;14-34;20-41;24-43.
  • ·Literature 1
    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.
    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.