• DRAMP ID

    • DRAMP00657
    • Peptide Name

    • Defensin-like protein 219 (Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • FFKKLFLRASNIMIKSISEGKSQFSGPALSPNIDPADEHIGHSPEDMKIIFCQQCAFHCIEKKKNIAHCENSICRCTLEDIL
    • Sequence Length

    • 82
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00657.
    • Formula

    • C408H647N111O119S8
    • Absent Amino Acids

    • VWY
    • Common Amino Acids

    • I
    • Mass

    • 9267.78
    • PI

    • 7.05
    • Basic Residues

    • 14
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 27
    • Net Charge

    • +4
    • Boman Index

    • -120.72
    • Hydrophobicity

    • -0.172
    • Aliphatic Index

    • 82.2
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 4.63
    • Polar Residues

    • 22

DRAMP00657

    • Function

    • Defense response to fungus.
    • PTM

    • Contains three disulfide bonds (By similarity).
    • Caution

    • Lacks 1 of the 4 disulfide bonds, which are conserved features of the family.
  • ·Literature 1
    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.
    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.
    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.