• DRAMP ID

    • DRAMP00669
    • Peptide Name

    • Defensin-like protein 232 (Protein SCRL23; SCR-like protein 23; Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the DEFL family
    • Gene

    • SCRL23
    • Sequence

    • GAPPVECWSEILFSGKCGFHGKKKCYKEMESKLKQRVLKCRCEDVKKDSNTSKDEHYCGCQRENPYECN
    • Sequence Length

    • 69
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00669.
    • Formula

    • C341H537N99O106S9
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • K
    • Mass

    • 8008.15
    • PI

    • 8.44
    • Basic Residues

    • 16
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +5
    • Boman Index

    • -187.57
    • Hydrophobicity

    • -1.12
    • Aliphatic Index

    • 36.67
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10470
    • Absorbance 280nm

    • 153.97
    • Polar Residues

    • 25

DRAMP00669

    • Function

    • May have antifungal activity.
    • PTM

    • Contains four disulfide bonds (By similarity).
    • Tissue specificity

    • Flower buds.
  • ·Literature 1
    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.
    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.
  • ·Literature 2
    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.
    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.
    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.