• DRAMP ID

    • DRAMP00780
    • Peptide Name

    • Viphi A (Plants)
    • Source

    • Viola philippica
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GSIPCGESCVFIPCISSVIGCACKSKVCYKN
    • Sequence Length

    • 31
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • SMILES

    • Not available
    • Biological Activity

    • Anti-cancer
    • Target Organism

      • Cancer cell lines:
        Target OrganismActivity
        BGC-823IC50=1.75±0.05 µM
        MM96LIC50=4.91±0.04 µM
        HeLaIC50=15.5±0.06 µM
      • Non-cancer cell line:
        Target OrganismActivity
        HFF-1IC50=3.19±0.01 µM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C136H223N35O41S6
    • Absent Amino Acids

    • DHLMQRTW
    • Common Amino Acids

    • C
    • Mass

    • 3196.84
    • PI

    • 8.33
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +2
    • Boman Index

    • -0.15
    • Hydrophobicity

    • 0.703
    • Aliphatic Index

    • 81.61
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 62.17
    • Polar Residues

    • 16

DRAMP00780

DRAMP00780 chydropathy plot
    • Function

    • The novel cyclotides show cytotoxic activity against several cancer cell lines.
  • ·Literature 1
    • Title

    • Isolation and characterization of cytotoxic cyclotides from Viola philippica.
    • Reference

    • Peptides. 2011 Aug;32(8):1719-1723.
    • Author

    • He W, Chan LY, Zeng G, Daly NL, Craik DJ, Tan N.