• DRAMP ID

    • DRAMP00963
    • Peptide Name

    • Thionin BTH7 (Plant defensin)
    • Source

    • Hordeum vulgare (Barley)
    • Family

    • Belongs to the thionin family
    • Gene

    • Not found
    • Sequence

    • KSCCKNTTGRNCYNACRFAGGSRPVCATACGCKIISGPTCPRDYPK
    • Sequence Length

    • 46
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Cytotoxic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00963.
    • Formula

    • C199H325N65O61S8
    • Absent Amino Acids

    • EHLMQW
    • Common Amino Acids

    • C
    • Mass

    • 4860.65
    • PI

    • 9.25
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +7
    • Boman Index

    • -92.24
    • Hydrophobicity

    • -0.448
    • Aliphatic Index

    • 31.96
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 77.33
    • Polar Residues

    • 25

DRAMP00963

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.
    • PTM

    • Contains four disulfide bonds 3-40;4-32;12-30;16-26.
  • ·Literature 1
    • Title

    • Specific and distinct expression patterns of two members of the thionin multigene family of barley in transgenic tobacco.
    • Reference

    • Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases
    • Author

    • Holtorf S, Schuetz C, Apel K, Bohlmann H.