General Information

    • DRAMP ID

    • DRAMP01219

    • Peptide Name

    • Palustrin-2LTa (Frogs, amphibians, animals)

    • Source

    • Hylarana latouchii (Broad-folded frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SLWENFKNAGKQFILNILDKIRCRVAGGCRT

    • Sequence Length

    • 31

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

    • SMILES

    • CC[C@@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CO)[C@H](C)CC)[C@H](C)CC)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H]1CSSC[C@@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)O)[C@@H](C)O)NC(=O)CNC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCCNC(=N)N)NC1=O

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC2592MIC=1.7 µM
        Bacillus licheniformis X39MIC=14 µM
        Psychrobacter faecalis X29MIC=1.7 µM

    • Hemolytic Activity

      • [Ref.22426384] It has hemolytic activities (LD50=220μM) against human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys23 and Cys29.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • Predicted Structure

    • There is no predicted structure for DRAMP01219.

Physicochemical Information

    • Formula

    • C157H256N48O42S2

    • Absent Amino Acids

    • HMPY

    • Common Amino Acids

    • GIKLNR

    • Mass

    • 3552.18

    • PI

    • 9.84

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -57.52

    • Hydrophobicity

    • -0.21

    • Aliphatic Index

    • 91.29

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 187.5

    • Polar Residues

    • 10

DRAMP01219

Comments Information

    • Function

    • Has antibacterial avctivity.

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and characterization of antimicrobial peptides from skin of the broad-folded frog, Hylarana latouchii.

    • Reference

    • Biochimie. 2012 Jun;94(6):1317-1326.

    • Author

    • Wang H, Yu Z, Hu Y, Yu H, Ran R, Xia J, Wang D, Yang S, Yang X, Liu J.