• DRAMP ID

    • DRAMP01522
    • Peptide Name

    • Rugosin-C (Frogs, amphibians, animals)
    • Source

    • Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa)
    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)
    • Gene

    • Not found
    • Sequence

    • GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC
    • Sequence Length

    • 37
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacterium:
        Target OrganismActivity
        Staphylococcus aureus 209P-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01522.
    • Formula

    • C168H285N45O49S3
    • Absent Amino Acids

    • EHNPRWY
    • Common Amino Acids

    • K
    • Mass

    • 3815.56
    • PI

    • 9.51
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +4
    • Boman Index

    • -16.75
    • Hydrophobicity

    • 0.246
    • Aliphatic Index

    • 89.73
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 3.47
    • Polar Residues

    • 12

DRAMP01522

    • Function

    • Has antibacterial activity against Gram-positive bacteria.
    • Tissue specificity

    • Expressed by the skin glands.
    • PTM

    • Contains one disulfide bond 31-37.
  • ·Literature 1
    • Title

    • Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.
    • Reference

    • Biochem. Biophys. Res. Commun. 1995; 212: 249-254.
    • Author

    • Suzuki S, Ohe Y, Kagegawa T, Tatemoto K.