• DRAMP ID

    • DRAMP01714
    • Peptide Name

    • OGF2 antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Odorrana grahami (Yunnanfu frog) (Rana grahami)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTMKKSLLLLFFLGTINLSFCQEETNAEEERRDEEVAKMEEIKRGLLSGPRCGEESTMWT
    • Sequence Length

    • 61
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C309H495N81O98S6
    • Absent Amino Acids

    • HY
    • Common Amino Acids

    • E
    • Mass

    • 7105.17
    • PI

    • 4.73
    • Basic Residues

    • 8
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 18
    • Net Charge

    • -4
    • Boman Index

    • -123.95
    • Hydrophobicity

    • -0.425
    • Aliphatic Index

    • 71.97
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 93.75
    • Polar Residues

    • 17

DRAMP01714

DRAMP01714 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Odorrana grahmi antimicrobial peptide cDNA sequences.
    • Reference

    • Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases
    • Author

    • Wang X, Lai R.