General Information

    • DRAMP ID

    • DRAMP01865

    • Peptide Name

    • Odorranain-A-RA1 antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Odorrana andersonii (golden crossband frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTMKKSLLLLFFLGTISLSLCEQERDAEEEEGSENGAEDIKLNRVVKCSYRLGSPDSRCN

    • Sequence Length

    • 61

    • Protein Existence

    • Homology

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antibiotic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C296H481N81O98S5

    • Absent Amino Acids

    • HW

    • Common Amino Acids

    • LE

    • Mass

    • 6902.86

    • PI

    • 4.79

    • Basic Residues

    • 8

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 18

    • Net Charge

    • -3

    • Boman Index

    • -130

    • Hydrophobicity

    • -0.372

    • Aliphatic Index

    • 83.11

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 26.92

    • Polar Residues

    • 20

DRAMP01865

DRAMP01865 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • The highest antimicrobial peptides diversity, skin antimicrobial peptides peptidomics of Amphibian, Rana andersonii.

    • Reference

    • Submitted (OCT-2009) to the EMBL/GenBank/DDBJ databases

    • Author

    • Yang X, Liang X, Zhang Y, Lee WH.
  • ·Literature 2

    • Title

    • Reference

    • Author