• DRAMP ID

    • DRAMP01866
    • Peptide Name

    • Mantzorumin-D1 antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Amolops mantzorum
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSLLLLFFLGTINLSLCEQERDADEEERRDDDEMDVEVEKRFLPLFLPKIICAITKKC
    • Sequence Length

    • 63
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antibiotic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C333H541N83O99S5
    • Absent Amino Acids

    • HWY
    • Common Amino Acids

    • L
    • Mass

    • 7451.76
    • PI

    • 4.71
    • Basic Residues

    • 10
    • Acidic Residues

    • 14
    • Hydrophobic Residues

    • 24
    • Net Charge

    • -4
    • Boman Index

    • -116.59
    • Hydrophobicity

    • -0.121
    • Aliphatic Index

    • 105.24
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 2.02
    • Polar Residues

    • 10

DRAMP01866

DRAMP01866 chydropathy plot
    • Function

    • Amphibian defense peptide.
  • ·Literature 1
    • Title

    • Antimicrobial peptides from amphibian skin of Amolops mantzorum.
    • Reference

    • Submitted (AUG-2010) to the EMBL/GenBank/DDBJ databases
    • Author

    • Wang H, Liu J.
  • ·Literature 2
    • Title

    • Reference

    • Author