General Information

    • DRAMP ID

    • DRAMP01867

    • Peptide Name

    • Hainanensisin-A4 antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Amolops hainanensis (Hainan sucker frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFVLGVVTKLLPSLFCMITKKC

    • Sequence Length

    • 67

    • Protein Existence

    • Homology

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antibiotic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C350H577N91O103S6

    • Absent Amino Acids

    • HWY

    • Common Amino Acids

    • L

    • Mass

    • 7900.34

    • PI

    • 5.4

    • Basic Residues

    • 12

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 24

    • Net Charge

    • -1

    • Boman Index

    • -130.55

    • Hydrophobicity

    • -0.136

    • Aliphatic Index

    • 98.81

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.89

    • Polar Residues

    • 13

DRAMP01867

DRAMP01867 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptides from amphibian skin of Amolops hainanensis.

    • Reference

    • Submitted (DEC-2010) to the EMBL/GenBank/DDBJ databases

    • Author

    • Wang H, Liu J.
  • ·Literature 2

    • Title

    • Reference

    • Author