• DRAMP ID

    • DRAMP02201
    • Peptide Name

    • Ranatuerin-2BYa (Frogs, amphibians, animals)
    • Source

    • Rana boylii (Foothill yellow-legged frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSLLLLFFLGTINLSLCEEERDAGDDQGEVVKQEVKRAFFTTFKNLVTNVAGTVIDKMKCKLTGEC
    • Sequence Length

    • 71
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02201.
    • Formula

    • C356H580N90O106S5
    • Absent Amino Acids

    • HPWY
    • Common Amino Acids

    • L
    • Mass

    • 7977.36
    • PI

    • 6.19
    • Basic Residues

    • 10
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 27
    • Net Charge

    • 0
    • Boman Index

    • -85.94
    • Hydrophobicity

    • 0.063
    • Aliphatic Index

    • 94.65
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.79
    • Polar Residues

    • 20

DRAMP02201

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Non-lethal collection of skin secretions for expression analysis and identification of antimicrobial peptide transcripts from six North American frog species.
    • Reference

    • Dis. Aquat. Organ. 2013,0:0-0.
    • Author

    • Robertson LS, Fellers GM, Marranca JM, Kleeman PM.