• DRAMP ID

    • DRAMP02203
    • Peptide Name

    • Ranatuerin-5Ca antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTMKKSLLLLFFLGTINLSLCEEERDADQEERRDDPGERDVQVEKRFLPIAPMLGKYLGK
    • Sequence Length

    • 61
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02203.
    • Formula

    • C317H512N84O94S4
    • Absent Amino Acids

    • HW
    • Common Amino Acids

    • L
    • Mass

    • 7132.3
    • PI

    • 5.02
    • Basic Residues

    • 10
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 20
    • Net Charge

    • -2
    • Boman Index

    • -128.67
    • Hydrophobicity

    • -0.439
    • Aliphatic Index

    • 89.51
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 24.83
    • Polar Residues

    • 11

DRAMP02203

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Identification and characterization of a novel antimicrobial peptidefrom Rana catesbeiana.
    • Reference

    • Submitted (MAR-2009) to the EMBL/GenBank/DDBJ database
    • Author

    • Zhao R, Han W, Han J, Lei L, Feng X, Sun C, Jiang L.