• DRAMP ID

    • DRAMP02216
    • Peptide Name

    • Ranatuerin-2TOd (Frogs, amphibians, animals)
    • Source

    • Rana tagoi okiensis (Oki brown frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSMLLLFFLGTISLSLCQEERGADEDDGGEMTEEVKRGLLNVIKDTAQNLFTAALEKLKCKVTKCN
    • Sequence Length

    • 71
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C347H576N90O108S6
    • Absent Amino Acids

    • HPWY
    • Common Amino Acids

    • L
    • Mass

    • 7929.29
    • PI

    • 5.33
    • Basic Residues

    • 10
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 25
    • Net Charge

    • -1
    • Boman Index

    • -97.66
    • Hydrophobicity

    • -0.085
    • Aliphatic Index

    • 94.79
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.79
    • Polar Residues

    • 20

DRAMP02216

DRAMP02216 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Cloning and expression of genes enocoding antimicrobial peptides andbradykinin from the skin and brain of Oki Tago's brown frog, Ranatagoi okiensis.
    • Reference

    • Peptides 2010,0:0-0.
    • Author

    • Tazato S, Conlon J.M, Iwamuro S.