• DRAMP ID

    • DRAMP02338
    • Peptide Name

    • Beta-defensin 1 (fish, chordates, animals)
    • Source

    • Oncorhynchus mykiss (Rainbow trout)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MVTLVLLVFLLLNVVEDEAASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF
    • Sequence Length

    • 60
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02338.
    • Formula

    • C299H466N68O77S8
    • Absent Amino Acids

    • IQWY
    • Common Amino Acids

    • L
    • Mass

    • 6501.88
    • PI

    • 5.51
    • Basic Residues

    • 4
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 27
    • Net Charge

    • 0
    • Boman Index

    • 36.18
    • Hydrophobicity

    • 1.108
    • Aliphatic Index

    • 108.67
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 6.36
    • Polar Residues

    • 19

DRAMP02338

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Expression and antiviral activity of a beta-defensin-like peptide identified in the rainbow trout (Oncorhynchus mykiss) EST sequences.
    • Reference

    • Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases
    • Author

    • Falco A, Chico V, Marroqui L, Perez L, Coll J.M, Estepa A.