• DRAMP ID

    • DRAMP02392
    • Peptide Name

    • Hematopoietic antimicrobial peptide-29 (MgCath29; hagfishes, chordates, animals)
    • Source

    • Myxine glutinosa (Atlantic hagfish)
    • Family

    • Not found
    • Gene

    • CATH29
    • Sequence

    • GWFKKAWRKVKNAGRVLKGVGIHYGVGLIG
    • Sequence Length

    • 30
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C156H248N46O33
    • Absent Amino Acids

    • CDEMPQST
    • Common Amino Acids

    • G
    • Mass

    • 3295.97
    • PI

    • 11.26
    • Basic Residues

    • 8
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +8
    • Boman Index

    • -15.35
    • Hydrophobicity

    • -0.043
    • Aliphatic Index

    • 97.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12490
    • Absorbance 280nm

    • 430.69
    • Polar Residues

    • 9

DRAMP02392

DRAMP02392 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Hagfish intestinal antimicrobial peptides are ancient cathelicidins.
    • Reference

    • Peptides. 2003 Nov;24(11):1655-1667.
    • Author

    • Uzzell T, Stolzenberg ED, Shinnar AE, Zasloff M.