General Information

    • DRAMP ID

    • DRAMP02406

    • Peptide Name

    • Antimicrobial protein 2 (Si-AMP2; Plants)

    • Source

    • Sesamum indicum (Oriental sesame) (Sesamum orientale)

    • Family

    • Belongs to the 2S seed storage albumins family

    • Gene

    • Not found

    • Sequence

    • QEGCEWESRPCNRGCWLPRQWESVHMRFGVLVLWRAPQFEHFRECCNELRCEALRCMMRMRMEYWPRGLQDQQVYQRARDLEPRKHCGMSYPVECRMPR

    • Sequence Length

    • 99

    • Protein Existence

    • Protein level

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02406.

Physicochemical Information

    • Formula

    • C527H810N168O141S16

    • Absent Amino Acids

    • IT

    • Common Amino Acids

    • R

    • Mass

    • 12268.23

    • PI

    • 8.67

    • Basic Residues

    • 20

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +7

    • Boman Index

    • -299.95

    • Hydrophobicity

    • -0.902

    • Aliphatic Index

    • 45.25

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 32470

    • Absorbance 280nm

    • 331.33

    • Polar Residues

    • 22

DRAMP02406

Comments Information

    • Function

    • Has antibacterial activity against Gram-negative Klebsiella sp. but not against E. coli, Proteus sp., Salmonella sp. and Xanthomonas sp. or against Gram-positive bacteria S.pyogenes, S. aureus and Rathayibacter sp. Has no antifungal activity.

Literature Information

  • ·Literature 1

    • Title

    • Bactericidal activity identified in 2S Albumin from sesame seeds and in silico studies of structure-function relations.

    • Reference

    • Protein J. 2011 Jun;30(5):340-350.

    • Author

    • Maria-Neto S, Honorato RV, Costa FT, Almeida RG, Amaro DS, Oliveira JT, Vasconcelos IM, Franco OL.