General Information

    • DRAMP ID

    • DRAMP02408

    • Peptide Name

    • 2S albumin (To-A1)

    • Source

    • Taraxacum officinale (Common dandelion) (Leontodon taraxacum)

    • Family

    • Belongs to the 2S seed storage albumins family

    • Gene

    • Not found

    • Sequence

    • PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi:
        Target OrganismActivity
        Helminthosporium sativumIC50=62.5 µg/ml
        Pemphigus betaeIC50=62.5 µg/ml

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02408.

Physicochemical Information

    • Formula

    • C202H331N71O74S7

    • Absent Amino Acids

    • AHKTWY

    • Common Amino Acids

    • Q

    • Mass

    • 5162.7

    • PI

    • 5.01

    • Basic Residues

    • 4

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 6

    • Net Charge

    • -1

    • Boman Index

    • -156.81

    • Hydrophobicity

    • -1.214

    • Aliphatic Index

    • 39.77

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 8.72

    • Polar Residues

    • 14

DRAMP02408

Comments Information

    • Function

    • This is a 2S seed storage protein. Has antifungal activity. Inhibits growth of H.sativum, V.albo-atrum and P. infestans.

    • Subunit structure

    • The sequence shown is the mature protein which consists of a small and a large chain linked by 2 disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Antifungal activity of storage 2S albumins from seeds of the invasive weed dandelion Taraxacum officinale Wigg.

    • Reference

    • Protein Pept Lett. 2010 Apr;17(4):522-529.

    • Author

    • Odintsova TI, Rogozhin EA, Sklyar IV, Musolyamov AK, Kudryavtsev AM, Pukhalsky VA, Smirnov AN, Grishin EV, Egorov TA.