• DRAMP ID

    • DRAMP02469
    • Peptide Name

    • Alpha-lytic protease L1
    • Source

    • Lysobacter sp. (strain XL1)
    • Family

    • Belongs to the peptidase S1 family
    • Gene

    • Not found
    • Sequence

    • VNVLGGIEYSINNATLCSVGFSVRVFNYAEGAVRGLTQGNACMGRGDSGGSWFTLFERQYGL
    • Sequence Length

    • 62
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C291H444N82O89S3
    • Absent Amino Acids

    • HKP
    • Common Amino Acids

    • G
    • Mass

    • 6611.4
    • PI

    • 6.21
    • Basic Residues

    • 4
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 22
    • Net Charge

    • 0
    • Boman Index

    • -62.82
    • Hydrophobicity

    • 0.108
    • Aliphatic Index

    • 78.55
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10095
    • Absorbance 280nm

    • 165.49
    • Polar Residues

    • 29

DRAMP02469

DRAMP02469 chydropathy plot
    • Function

    • Has bacteriolytic activity.
    • Biophysicochemical properties

    • pH dependence (Optimum pH is 8.0. Active from pH 7.0 to 11.0); Temperature dependence (Optimum temperature is 70 degrees Celsius).
  • ·Literature 1
    • Title

    • Identification of extracellular bacteriolytic enzymes from Lysobacter sp. XL1.
    • Reference

    • Submitted (APR-2007) to UniProtKB
    • Author

    • Muranova T.A, Stepnaya O.A, Tsfasman I.M, Kulaev I.S.