General Information

    • DRAMP ID

    • DRAMP02489

    • Peptide Name

    • Supwaprin-a (Snakes, reptiles, animals)

    • Source

    • Austrelaps superbus (Lowland copperhead snake) (Hoplocephalussuperbus)

    • Family

    • Belongs to the snake waprin family

    • Gene

    • Not found

    • Sequence

    • QDRPKKPGLCPPRPQKPPCVRECKNDWSCPGEQKCCRYGCIFECRDPIFVK

    • Sequence Length

    • 51

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antimalarial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02489 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02489.

Physicochemical Information

    • Formula

    • C256H405N77O70S8

    • Absent Amino Acids

    • AHMT

    • Common Amino Acids

    • PC

    • Mass

    • 5937.99

    • PI

    • 8.9

    • Basic Residues

    • 11

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +5

    • Boman Index

    • -137.1

    • Hydrophobicity

    • -1.033

    • Aliphatic Index

    • 34.31

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 149.8

    • Polar Residues

    • 14

DRAMP02489

DRAMP02489 chydropathy plot

Comments Information

    • Function

    • Damages membranes of susceptible bacteria. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

    • PTM

    • Contains four disulfide bonds (By similarity).

    • Domain

    • Contains 1 WAP domain.

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of Waprins from the venom of Australian elapid snakes.

    • Reference

    • Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • St Pierre L.