• DRAMP ID

    • DRAMP02489
    • Peptide Name

    • Supwaprin-a (Snakes, reptiles, animals)
    • Source

    • Austrelaps superbus (Lowland copperhead snake) (Hoplocephalussuperbus)
    • Family

    • Belongs to the snake waprin family
    • Gene

    • Not found
    • Sequence

    • QDRPKKPGLCPPRPQKPPCVRECKNDWSCPGEQKCCRYGCIFECRDPIFVK
    • Sequence Length

    • 51
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antimalarial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C256H405N77O70S8
    • Absent Amino Acids

    • AHMT
    • Common Amino Acids

    • PC
    • Mass

    • 5937.99
    • PI

    • 8.9
    • Basic Residues

    • 11
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +5
    • Boman Index

    • -137.1
    • Hydrophobicity

    • -1.033
    • Aliphatic Index

    • 34.31
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7490
    • Absorbance 280nm

    • 149.8
    • Polar Residues

    • 14

DRAMP02489

DRAMP02489 chydropathy plot
    • Function

    • Damages membranes of susceptible bacteria. Does not inhibit the proteinases elastase and cathepsin G (By similarity).
    • PTM

    • Contains four disulfide bonds (By similarity).
    • Domain

    • Contains 1 WAP domain.
  • ·Literature 1
    • Title

    • Identification and characterization of Waprins from the venom of Australian elapid snakes.
    • Reference

    • Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases
    • Author

    • St Pierre L.