• DRAMP ID

    • DRAMP02538
    • Peptide Name

    • CRISPR-associated endoribonuclease Cas2 2 (Antiviral defensin)
    • Source

    • Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 /YP87)
    • Family

    • Belongs to the CRISPR-associated endoribonuclease Cas2 prote
    • Gene

    • cas2-2
    • Sequence

    • MRLPYLVCYDISDEGRLNRVYRFMKGKGFHIQYSVFYCILTDVELKEMKAEILKLIHSRYDDVRIYPLPNNSLVAVLGVGDRIPDGVEVFY
    • Sequence Length

    • 91
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Metal-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C489H761N125O133S5
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • LV
    • Mass

    • 10679.48
    • PI

    • 6.71
    • Basic Residues

    • 14
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 33
    • Net Charge

    • +2
    • Boman Index

    • -124.52
    • Hydrophobicity

    • 0.006
    • Aliphatic Index

    • 106.92
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12045
    • Absorbance 280nm

    • 133.83
    • Polar Residues

    • 24

DRAMP02538

DRAMP02538 chydropathy plot
    • Function

    • CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease (By similarity).
  • ·Literature 1
    • Title

    • The complete genome sequence of Thermodesulfovibrio yellowstonii strain ATCC 51303 / DSM 11347 / YP87.
    • Reference

    • Submitted (AUG-2008) to the EMBL/GenBank/DDBJ databases
    • Author

    • Dodson R.J, Durkin A.S, Wu M, Eisen J, Sutton G.