• DRAMP ID

    • DRAMP02619
    • Peptide Name

    • Beta-defensin 119 (Defensin, beta 119; Beta-defensin 120; Defensin, beta 120; primates, mammals,
    • Source

    • Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB119
    • Sequence

    • KRHNLRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
    • Sequence Length

    • 63
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C322H503N99O95S8
    • Absent Amino Acids

    • FV
    • Common Amino Acids

    • CRSKNY
    • Mass

    • 7537.62
    • PI

    • 9.19
    • Basic Residues

    • 12
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +7
    • Boman Index

    • -179
    • Hydrophobicity

    • -1.07
    • Aliphatic Index

    • 46.51
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 18825
    • Absorbance 280nm

    • 303.63
    • Polar Residues

    • 26

DRAMP02619

DRAMP02619 chydropathy plot
    • Function

    • Has antibacterial activity (Potential).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hollox EJ, Armour JAL.