• DRAMP ID

    • DRAMP02632
    • Peptide Name

    • Beta-defensin 121 (Defensin, beta 121; primates, mammals, animals)
    • Source

    • Macaca mulatta (Rhesus macaque)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB121
    • Sequence

    • QVTPVTKCWGKSGRCRTTCKKSEVYYILCKTEAKCCVDPKYVPVRSKLTDTNTSLESTSAV
    • Sequence Length

    • 61
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02632.
    • Formula

    • C292H483N81O92S6
    • Absent Amino Acids

    • FHM
    • Common Amino Acids

    • TK
    • Mass

    • 6792.9
    • PI

    • 9.17
    • Basic Residues

    • 11
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +6
    • Boman Index

    • -119.69
    • Hydrophobicity

    • -0.439
    • Aliphatic Index

    • 62.13
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10345
    • Absorbance 280nm

    • 172.42
    • Polar Residues

    • 27

DRAMP02632

    • Function

    • Has antibacterial activity (Potential).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Differential expression of a primate beta defensin gene cluster specific to male reproductive tract.
    • Reference

    • Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
    • Author

    • Yashwanth R, Hamil K.G, Yenugu S, French F.S, Hall S.H.