• DRAMP ID

    • DRAMP02672
    • Peptide Name

    • Beta-defensin 4A (Beta-defensin 2, BD-2; primates, mammals, animals)
    • Source

    • Pan troglodytes (Chimpanzee)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB4A
    • Sequence

    • GISDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
    • Sequence Length

    • 41
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C189H313N55O51S6
    • Absent Amino Acids

    • EMNW
    • Common Amino Acids

    • C
    • Mass

    • 4364.26
    • PI

    • 9.3
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +7
    • Boman Index

    • -41.31
    • Hydrophobicity

    • -0.112
    • Aliphatic Index

    • 64.15
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 46.63
    • Polar Residues

    • 17

DRAMP02672

DRAMP02672 chydropathy plot
    • Function

    • Problely has antimicrobial activity.
    • PTM

    • Problely contains three disulfide bonds 8-37; 15-30; 20-38.
  • ·Literature 1
    • Title

    • Expression of beta-defensin-2 in chimpanzee (Pan troglodytes).
    • Reference

    • Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    • Author

    • Duits LA, Langermans JAM, van der Straaten T, Vervenne RAW, Paltansing S, Frost PA, Hiemstra PS, Thomas AW, Nibbering PH.