• DRAMP ID

    • DRAMP02705
    • Peptide Name

    • Beta-defensin 132 (Defensin, beta 132; primates, mammals,animals)
    • Source

    • Gorilla gorilla gorilla (Lowland gorilla)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB132
    • Sequence

    • GGSKCVSNTPAYCRTYCHWGETALFMFNASRKCCISYSFLPKPDLPQLIGNHWQSRRNTQRKDKKQQTTVTS
    • Sequence Length

    • 72
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02705.
    • Formula

    • C360H560N108O105S6
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • STK
    • Mass

    • 8273.43
    • PI

    • 9.67
    • Basic Residues

    • 13
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +10
    • Boman Index

    • -168.8
    • Hydrophobicity

    • -0.801
    • Aliphatic Index

    • 44.72
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 15720
    • Absorbance 280nm

    • 221.41
    • Polar Residues

    • 30

DRAMP02705

    • Function

    • Potentially has antibacterial activity.
    • PTM

    • Contains two disulfide bonds 5-33; 17-34.
  • ·Literature 1
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hollox E.J, Armour J.A.L.