• DRAMP ID

    • DRAMP03004
    • Peptide Name

    • Abaecin (Insects, animals)
    • Source

    • Bombus pascuorum (Brown bumblebee)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH
    • Sequence Length

    • 39
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Micrococcus luteus;-
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli D22-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03004 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03004.
    • Formula

    • C213H294N54O49
    • Absent Amino Acids

    • ACDEMT
    • Common Amino Acids

    • P
    • Mass

    • 4395.01
    • PI

    • 10
    • Basic Residues

    • 5
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +5
    • Boman Index

    • -41.53
    • Hydrophobicity

    • -1.026
    • Aliphatic Index

    • 27.44
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 223.16
    • Polar Residues

    • 11

DRAMP03004

DRAMP03004 chydropathy plot
    • Function

    • Antibacterial peptide against Gram-positive and Gram-negative bacteria.
    • Induction

    • By bacterial infection.
  • ·Literature 1
    • Title

    • Novel antibacterial peptides isolated from a European bumblebee, Bombus pascuorum (Hymenoptera, Apoidea).
    • Reference

    • Insect Biochem Mol Biol. 1997 May;27(5):413-22.
    • Author

    • Rees JA, Moniatte M, Bulet P.