General Information

    • DRAMP ID

    • DRAMP03141

    • Peptide Name

    • Putative defensin 5

    • Source

    • Anopheles gambiae (African malaria mosquito)

    • Family

    • Not found

    • Gene

    • DEF5

    • Sequence

    • QTPCSSAKKVRCNVHCRGYTKLGSCYDDNCSCVDKPAAMKASFAA

    • Sequence Length

    • 45

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03141 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03141.

Physicochemical Information

    • Formula

    • C199H321N61O64S7

    • Absent Amino Acids

    • EIW

    • Common Amino Acids

    • AC

    • Mass

    • 4816.53

    • PI

    • 8.87

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -86.86

    • Hydrophobicity

    • -0.396

    • Aliphatic Index

    • 41.33

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 76.25

    • Polar Residues

    • 19

DRAMP03141

DRAMP03141 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The salivary transcriptome of Anopheles gambiae (Diptera: Culicidae) larvae: A microarray-based analysis.

    • Reference

    • Insect Biochem Mol Biol. 2009 May-Jun;39(5-6):382-394.

    • Author

    • Neira Oviedo M, Ribeiro JM, Heyland A, VanEkeris L, Moroz T, Linser PJ.