General Information

    • DRAMP ID

    • DRAMP03142

    • Peptide Name

    • AGAP004632-PA (Defensin)

    • Source

    • Anopheles gambiae (African malaria mosquito)

    • Family

    • Not found

    • Gene

    • DEF2

    • Sequence

    • STCKLFTADVVSSITCKMYCVIKGKTGGYCNSEGLCTCRAEDLHFLLKPIINKD

    • Sequence Length

    • 54

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03142 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03142.

Physicochemical Information

    • Formula

    • C257H419N67O78S7

    • Absent Amino Acids

    • QW

    • Common Amino Acids

    • CKLT

    • Mass

    • 5919.98

    • PI

    • 8.25

    • Basic Residues

    • 8

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +3

    • Boman Index

    • -52.9

    • Hydrophobicity

    • 0.141

    • Aliphatic Index

    • 84.81

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 63.3

    • Polar Residues

    • 23

DRAMP03142

DRAMP03142 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The genome sequence of the malaria mosquito Anopheles gambiae.

    • Reference

    • Science. 2002 Oct 4;298(5591):129-149.

    • Author

    • Holt RA, Subramanian GM, Halpern A, Sutton GG, Charlab R, et al, Collins FH, Hoffman SL.