• DRAMP ID

    • DRAMP03345
    • Peptide Name

    • Alpha-defensin cryptdin-20 (Defensin-related cryptdin-20; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the alpha-defensin family
    • Gene

    • Defa20
    • Sequence

    • SRDLICYCRKGGCNRGEQVYGTCSGRLLYCCPRR
    • Sequence Length

    • 34
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C159H261N55O47S6
    • Absent Amino Acids

    • AFHMW
    • Common Amino Acids

    • CR
    • Mass

    • 3887.52
    • PI

    • 9.15
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +5
    • Boman Index

    • -96.47
    • Hydrophobicity

    • -0.577
    • Aliphatic Index

    • 54.41
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 146.82
    • Polar Residues

    • 18

DRAMP03345

DRAMP03345 chydropathy plot
    • Function

    • May have microbicidal activities (By similarity).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Unknown
    • Reference

    • Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases
    • Author

    • Chen B, Zha Y, Xu X, Deng X.