• DRAMP ID

    • DRAMP03371
    • Peptide Name

    • Beta-defensin 5 (BD-5, mBD-5; Defensin, beta 5; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb5
    • Sequence

    • KTINNPVSCCMIGGICRYLCKGNILQNGNCGVTSLNCCKRK
    • Sequence Length

    • 41
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C181H312N58O54S8
    • Absent Amino Acids

    • ADEFHW
    • Common Amino Acids

    • C
    • Mass

    • 4421.3
    • PI

    • 9.21
    • Basic Residues

    • 6
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +6
    • Boman Index

    • -50.97
    • Hydrophobicity

    • 0.005
    • Aliphatic Index

    • 80.73
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 46.63
    • Polar Residues

    • 23

DRAMP03371

DRAMP03371 chydropathy plot
    • PTM

    • Contains three disulfide bonds 9-37; 16-30; 20-38.
  • ·Literature 1
    • Title

    • EST and genomic database mining yield novel human and mouse beta-defensins
    • Reference

    • Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    • Author

    • Adler D.A, Holloway J.L, Haldeman B.E, Rixon M, Jaspers S, Fox B, Gosink J, Sheppard P, Presnell S, Gao Z, Whitmore T, Stamm M, Laube D, Diamond G.