• DRAMP ID

    • DRAMP03377
    • Peptide Name

    • Beta-defensin 12 (BD-12, mBD-12; Defensin, beta 12; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb12
    • Sequence

    • GLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
    • Sequence Length

    • 51
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C248H397N75O72S7
    • Absent Amino Acids

    • DHM
    • Common Amino Acids

    • CEGR
    • Mass

    • 5805.76
    • PI

    • 8.58
    • Basic Residues

    • 9
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +3
    • Boman Index

    • -106.72
    • Hydrophobicity

    • -0.267
    • Aliphatic Index

    • 63.14
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 147.3
    • Polar Residues

    • 20

DRAMP03377

DRAMP03377 chydropathy plot
    • PTM

    • Contains three disulfide bonds 19-46; 26-40; 30-47.
    • Tissue specificity

    • Only expressed in epididymis (caput, corpus and cauda).
  • ·Literature 1
    • Title

    • Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
    • Reference

    • J Immunol. 2002 Sep 1;169(5):2516-2523.
    • Author

    • Yamaguchi Y, Nagase T, Makita R, Fukuhara S, Tomita T, Tominaga T, Kurihara H, Ouchi Y.
  • ·Literature 2
    • Title

    • The transcriptional landscape of the mammalian genome.
    • Reference

    • Science. 2005 Sep 2;309(5740):1559-1563.
    • Author

    • Carninci P, Kasukawa T, Katayama S, et al.
  • ·Literature 3
    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-12426.
    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.