• DRAMP ID

    • DRAMP03389
    • Peptide Name

    • Beta-defensin 34 (BD-34, mBD-34; Defensin, beta 34; Rodents, mammals, animals)
    • Source

    • Mus musculus (House mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb34
    • Sequence

    • FFFFDEKCSRINGRCTASCLKNEELVALCWKNLKCCVTVQSCGRSKGNQSDEGSGHMGTRG
    • Sequence Length

    • 61
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C282H449N87O89S8
    • Absent Amino Acids

    • PY
    • Common Amino Acids

    • CGS
    • Mass

    • 6738.68
    • PI

    • 8.57
    • Basic Residues

    • 10
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +4
    • Boman Index

    • -130.04
    • Hydrophobicity

    • -0.439
    • Aliphatic Index

    • 49.51
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 97.92
    • Polar Residues

    • 27

DRAMP03389

DRAMP03389 chydropathy plot
    • Function

    • Has antibacterial activity.
    • Tissue specificity

    • Only expressed in epididymis (caput, corpus and cauda).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-6.
    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.