• DRAMP ID

    • DRAMP03391
    • Peptide Name

    • Beta-defensin 36 (BD-36, mBD-36; Defensin, beta 36; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb36
    • Sequence

    • QKCWNLHGKCRHRCSRKESVYVYCTNGKMCCVKPKYQPKPKPWMF
    • Sequence Length

    • 45
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C242H376N72O58S8
    • Absent Amino Acids

    • ADI
    • Common Amino Acids

    • K
    • Mass

    • 5478.58
    • PI

    • 9.74
    • Basic Residues

    • 13
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +12
    • Boman Index

    • -100.5
    • Hydrophobicity

    • -1.018
    • Aliphatic Index

    • 28
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 15845
    • Absorbance 280nm

    • 360.11
    • Polar Residues

    • 16

DRAMP03391

DRAMP03391 chydropathy plot
    • PTM

    • Contains three disulfide bonds 3-30; 10-24; 14-31.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2
    • Title

    • The transcriptional landscape of the mammalian genome.
    • Reference

    • Science. 2005 Sep 2;309(5740):1559-1563.
    • Author

    • Carninci P, Kasukawa T, Katayama S, Gough J, Frith M.C, et al, Hayashizaki Y.