• DRAMP ID

    • DRAMP03392
    • Peptide Name

    • Beta-defensin 37 (BD-37, mBD-37; Defensin, beta 37; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb37
    • Sequence

    • QNNPVAMLDTIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCHKN
    • Sequence Length

    • 46
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C212H352N68O66S7
    • Absent Amino Acids

    • FSW
    • Common Amino Acids

    • CN
    • Mass

    • 5133.96
    • PI

    • 8.64
    • Basic Residues

    • 9
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +5
    • Boman Index

    • -98.01
    • Hydrophobicity

    • -0.602
    • Aliphatic Index

    • 65.65
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 41.44
    • Polar Residues

    • 19

DRAMP03392

DRAMP03392 chydropathy plot
    • PTM

    • Contains three disulfide bonds 13-42; 20-35; 25-43.
  • ·Literature 1
    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-12426.
    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.