General Information

    • DRAMP ID

    • DRAMP03407

    • Peptide Name

    • Defr1 (Murine beta-defensin related peptide; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • DPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK

    • Sequence Length

    • 34

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus;
      • Gram-negative bacteria:
        Target OrganismActivity
        Pseudomonas aeruginosa-
        Escherichia coli-
        Burkholderia cepacia-

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03407 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03407.

Physicochemical Information

    • Formula

    • C163H264N50O44S5

    • Absent Amino Acids

    • AEMW

    • Common Amino Acids

    • CG

    • Mass

    • 3788.5

    • PI

    • 9.26

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +6

    • Boman Index

    • -53.07

    • Hydrophobicity

    • -0.224

    • Aliphatic Index

    • 65.88

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3230

    • Absorbance 280nm

    • 97.88

    • Polar Residues

    • 16

DRAMP03407

DRAMP03407 chydropathy plot

Comments Information

    • The antimicrobial activity of Defr1 against S. aureus, E. coli, and B. cepacia was found to be reduced in raised concentration of NaCl, but its action against P. aeruginosa was independent of NaCl concentration.

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of a novel murine beta-defensin-related gene.

    • Reference

    • Mamm Genome. 2002 Aug;13(8):445-451.

    • Author

    • Morrison GM, Rolfe M, Kilanowski FM, Cross SH, Dorin JR.