• DRAMP ID

    • DRAMP03411
    • Peptide Name

    • Neutrophil defensin 4 (HANP-4; alpha-defensin; Rodents, mammals, animals)
    • Source

    • Mesocricetus auratus (Golden hamster)
    • Family

    • Belongs to the alpha-defensin family
    • Gene

    • Not found
    • Sequence

    • VTCFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus-
        Streptococcus pyogenes-
        Enterococcus faecalis;-
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli-
        Salmonella serotype krefeld-
        Klebsiella oxytoca-
        Pseudomonas aeruginosa-
      • Fungi: Candida albicans, Cryptococcus neoformans.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys3 and Cys31,Cys5 and Cys20,Cys10 and Cys30.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03411 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03411.
    • Formula

    • C161H255N49O47S6
    • Absent Amino Acids

    • AHMW
    • Common Amino Acids

    • C
    • Mass

    • 3821.46
    • PI

    • 8.67
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +3
    • Boman Index

    • -70.57
    • Hydrophobicity

    • -0.2
    • Aliphatic Index

    • 53.03
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 104.84
    • Polar Residues

    • 16

DRAMP03411

DRAMP03411 chydropathy plot
    • Function

    • Bactericidal activity, greater against Gram-positive bacteria. Low anti-fungi activity.
  • ·Literature 1
    • Title

    • Isolation, antimicrobial activities, and primary structures of hamster neutrophil defensins.
    • Reference

    • Infect Immun. 1996 Nov;64(11):4444-4449.
    • Author

    • Mak P, Wójcik K, Thogersen IB, Dubin A.