General Information

    • DRAMP ID

    • DRAMP03483

    • Peptide Name

    • Defensin-like protein 2 (Predicted; Insects, animals)

    • Source

    • Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

    • Family

    • Not found

    • Gene

    • Def2

    • Sequence

    • MKSSMLLLVCVTFLVIVSSPQNGVLADKLIGSCVWGAVDYTSNCNAECVRRGLR

    • Sequence Length

    • 54

    • Protein Existence

    • Transcript level

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C253H420N70O74S6

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • VL

    • Mass

    • 5818.9

    • PI

    • 8.49

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +2

    • Boman Index

    • -30.33

    • Hydrophobicity

    • 0.626

    • Aliphatic Index

    • 113.52

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 136.6

    • Polar Residues

    • 20

DRAMP03483

DRAMP03483 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Pyrosequencing the Manduca sexta larval midgut transcriptome: messages for digestion, detoxification and defence.

    • Reference

    • Insect Mol Biol. 2010 Feb;19(1):61-75.

    • Author

    • Pauchet Y, Wilkinson P, Vogel H, Nelson DR, Reynolds SE, Heckel DG, ffrench-Constant RH.