• DRAMP ID

    • DRAMP03488
    • Peptide Name

    • Defense protein 4 (DFP-4; Insects, animals)
    • Source

    • Lonomia obliqua (Moth)
    • Family

    • Belongs to the cecropin family
    • Gene

    • Not found
    • Sequence

    • WDFLKELEGVGQRVRDSIISAGPAIDVLKKSQGPRRWSRP
    • Sequence Length

    • 40
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C203H328N62O57
    • Absent Amino Acids

    • CHMNTY
    • Common Amino Acids

    • R
    • Mass

    • 4549.22
    • PI

    • 10.25
    • Basic Residues

    • 8
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +3
    • Boman Index

    • -99.05
    • Hydrophobicity

    • -0.655
    • Aliphatic Index

    • 85.25
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 11000
    • Absorbance 280nm

    • 282.05
    • Polar Residues

    • 8

DRAMP03488

DRAMP03488 chydropathy plot
    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).
  • ·Literature 1
    • Title

    • A catalog for the transcripts from the venomous structures of the caterpillar Lonomia obliqua: identification of the proteins potentially involved in the coagulation disorder and hemorrhagic syndrome.
    • Reference

    • Gene. 2005 Aug 1;355:11-27.
    • Author

    • Veiga AB, Ribeiro JM, Guimarães JA, Francischetti IM.