• DRAMP ID

    • DRAMP03490
    • Peptide Name

    • Gloverin (Insects, animals)
    • Source

    • Heliothis virescens (Tobacco budworm moth)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • VFGTLGSTDDSLFGRYKQDIFNDHRGHLQGQAYGSR
    • Sequence Length

    • 36
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C177H264N54O56
    • Absent Amino Acids

    • CEMPW
    • Common Amino Acids

    • G
    • Mass

    • 4044.37
    • PI

    • 6.89
    • Basic Residues

    • 6
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +2
    • Boman Index

    • -93.28
    • Hydrophobicity

    • -0.842
    • Aliphatic Index

    • 54.17
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 85.14
    • Polar Residues

    • 14

DRAMP03490

DRAMP03490 chydropathy plot
    • Function

    • Antibacterial protein (By similarity).