• DRAMP ID

    • DRAMP03494
    • Peptide Name

    • Cecropin (Insects, animals)
    • Source

    • Oiketicus kirbyi (Bagworm moth)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • WKPFKKIEKAVRRVRDGVAKAGPAVAVVGQAT
    • Sequence Length

    • 32
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C156H262N48O39
    • Absent Amino Acids

    • CHLMNSY
    • Common Amino Acids

    • AV
    • Mass

    • 3434.09
    • PI

    • 11.12
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +6
    • Boman Index

    • -48
    • Hydrophobicity

    • -0.194
    • Aliphatic Index

    • 85.31
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 177.42
    • Polar Residues

    • 4

DRAMP03494

DRAMP03494 chydropathy plot
    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria. Has also activity against fungi