• • DRAMP ID

  • DRAMP03494

• • Peptide Name

  • Cecropin (Insects, animals)

• • Source

  • Oiketicus kirbyi (Bagworm moth)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • WKPFKKIEKAVRRVRDGVAKAGPAVAVVGQAT

• • Sequence Length

  • 32

• • UniProt Entry

  • P83420

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Antifungal

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03494.

DRAMP03494

• • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria. Has also activity against fungi

• ·Literature 1

• • Title

  • Unknown

• • Pubmed ID

  • PubMed ID is not available

• • Reference

  • Submitted (JUL-2002) to UniProtKB

• • Author

  • Bulet P.