• • DRAMP ID

  • DRAMP03501

• • Peptide Name

  • La-LTP (LJAFP; Insects, animals)

• • Source

  • Leonurus japonicus (Chinese motherwort) (Leonurus artemisia)

• • Family

  • Not found

• • Gene

  • Afp

• • Sequence

  • AIGCNTVASKMAPCLPYVTGKGPLGGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH

• • Sequence Length

  • 91

• • UniProt Entry

  • Q52RN7

• • Protein Existence

  • Homology

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive Bacteria:

      Target Organism	Activity
      Bacillus subtilis	IC50>15 µM

    • Gram-negative Bacteria:

      Target Organism	Activity
      Pseudomonas solanacearum	IC50=7.5-15 µM
      Ralstonia solanacearum	IC50=15 µM

    • Fungi:

      Target Organism	Activity
      Alternaria alternate	IC50<7.5 µM
      Alternaria brassicae	IC50<7.5 µM
      Aspergillus niger	IC50<7.5 µM
      Bipolaris maydis	IC50<7.5 µM
      Botrytis cinerea	IC50=7.5-15 µM
      Cerospora personata	IC50=7.5-15 µM
      Colletotrichum gloeosporiodes	IC50<7.5 µM
      Fusarium graminearum	IC50=7.5-15 µM
      Fusarium oxysporum	IC50=7.5-15 µM
      Penicillium digitatum	IC50>15 µM
      Pyricularia grisea	IC50=7.5-15 µM
      Rhizoctonia solani	IC50<7.5 µM
      Rhizoctonia cerealis	IC50=7.5-15 µM
      Saccharomyces cerevisiae	IC50>15 µM
      Sclerotinia sclerotiorum	IC50>15 µM
      Trichoderma harzianum	IC50=7.5-15 µM
      Verticillium dahliae	IC50=7.5-15 µM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Lipid-binding

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03501.

DRAMP03501

• • Function

  • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

• ·Literature 1

• • Title

  • LJAFP, a novel non-specific lipid transfer protein-like antimicrobial protein from motherwort (Leonurus japonicus) confers disease resistance against phytopathogenic fungi and bacterium in transgenic tobacco.

• • Pubmed ID

  • PubMed ID is not available

• • Reference

  • Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases

• • Author

  • Yang X, Xiao Y, Pei Y, Zhen C.