• DRAMP ID

    • DRAMP03505
    • Peptide Name

    • Hyphancin-3G (Hyphancin IIIG; Cecropin-A3; Insects, animals)
    • Source

    • Hyphantria cunea (Fall webworm moth)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • RWKVFKKIEKVGRHIRDGVIKAGPAITVVGQATAL
    • Sequence Length

    • 35
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03505.
    • Formula

    • C176H297N53O43
    • Absent Amino Acids

    • CMNSY
    • Common Amino Acids

    • KV
    • Mass

    • 3843.62
    • PI

    • 11.12
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +7
    • Boman Index

    • -42.27
    • Hydrophobicity

    • 0.017
    • Aliphatic Index

    • 108.57
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 161.76
    • Polar Residues

    • 6

DRAMP03505

    • Function

    • Has antibacterial activity.
    • PTM

    • C-terminal amidation.
  • ·Literature 1
    • Title

    • Differences in the skin peptides of the male and female Australian tree frog Litoria splendida. The discovery of the aquatic male sex pheromone splendipherin, together with Phe8 caerulein and the antibiotic peptide caerin 1.10.
    • Reference

    • Submitted MAR-1995 to the EMBL GenBank DDBJ databases.
    • Author

    • Park SS, Shin SW, Kim MK, Park DS, Oh HW, Park HY.