• DRAMP ID

    • DRAMP03598
    • Peptide Name

    • Human beta-defensin 2 (hBD-2; Defensin, beta 2; Beta-defensin 4A; Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB4A AND DEFB4B
    • Sequence

    • GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
    • Sequence Length

    • 41
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli D31MIC=62 µg/ml
        Escherichia coli ATCCMIC=62 µg/ml
        Pseudomonas aeruginosa ATCC (MIC=62 µg/ml);-
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCCMIC=62 µg/ml
        Enterococcus faecalis ATCCMIC=15 µg/ml
    • Hemolytic Activity

      • [Ref.15625724] It is slightly hemolytic (<12%) against human erythrocytes at the highest concentration of 500 μg/ml.
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys8 and Cys37,Cys15 and Cys30,Cys20 and Cys38.
    • Stereochemistry

    • L
    • Predicted Structure

    • Formula

    • C188H311N55O50S6
    • Absent Amino Acids

    • EMNW
    • Common Amino Acids

    • CG
    • Mass

    • 4334.24
    • PI

    • 9.3
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +7
    • Boman Index

    • -36.97
    • Hydrophobicity

    • -0.102
    • Aliphatic Index

    • 64.15
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 46.63
    • Polar Residues

    • 17

DRAMP03598

DRAMP03598 chydropathy plot
    • Function

    • Has anti-HIV and antibacterial activity.
    • Tissue specificity

    • Expressed in the skin and respiratory tract.
    • Induction

    • By inflammation.
    • PTM

    • Contains three disulfide bonds 8-37, 15-30, 20-38.
    • Transgenic plants

    • expression of this peptide in Arabidopsis thaliana reduced fungal infection.
  • ·Literature 1
    • Title

    • A peptide antibiotic from human skin.
    • Reference

    • Nature. 1997 Jun 26;387(6636):861.
    • Author

    • Harder J, Bartels J, Christophers E, Schröder JM.
  • ·Literature 2
    • Title

    • The structure of human beta-defensin-2 shows evidence of higher order oligomerization.
    • Reference

    • J Biol Chem. 2000 Oct 20;275(42):32911-32918.
    • Author

    • Hoover DM, Rajashankar KR, Blumenthal R, Puri A, Oppenheim JJ, Chertov O, Lubkowski J.
  • ·Literature 3
    • Title

    • Arabidopsis thaliana plants expressing human beta-defensin-2 are more resistant to fungal attack: functional homology between plant and human defensins.
    • Reference

    • Plant Cell Rep. 2007 Aug;26(8):1391-1398.
    • Author

    • Aerts AM, Thevissen K, Bresseleers SM, Sels J, Wouters P, Cammue BP, François IE.