• DRAMP ID

    • DRAMP03669
    • Peptide Name

    • Megourin-2 (arthropod; animals)
    • Source

    • Megoura viciae (Vetch aphid)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • YLDVNQIASYLLCLGQGAVFNGRKTCQIGCRAACQQPGCGGYKECEQIPNIRLHKYRCHCNSG
    • Sequence Length

    • 63
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03669.
    • Formula

    • C295H468N92O87S8
    • Absent Amino Acids

    • MW
    • Common Amino Acids

    • CG
    • Mass

    • 6952
    • PI

    • 8.71
    • Basic Residues

    • 9
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +6
    • Boman Index

    • -97.38
    • Hydrophobicity

    • -0.319
    • Aliphatic Index

    • 71.27
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6460
    • Absorbance 280nm

    • 104.19
    • Polar Residues

    • 27

DRAMP03669

    • Function

    • Has antimicrobial activity against Gram-positive bacteria and fungi.
    • Induction

    • By bacterial infection.
    • PTM

    • Contains four disulfide bonds.
  • ·Literature 1
    • Title

    • Unknown
    • Reference

    • Submitted (JUL-2002) to UniProtKB
    • Author

    • Bulet P, Charlet M, Chernish S, Hetru C.