General Information

    • DRAMP ID

    • DRAMP03697

    • Peptide Name

    • Neurotoxin MeuNaTx-2 (Arthropods, animals)

    • Source

    • Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus)

    • Family

    • Belongs to the Sodium channel inhibitor family (Alpha subfamily)

    • Gene

    • Not found

    • Sequence

    • ARDAYIANDRNCVYTCALNPYCDSECKKNGADSGYCQWFGRFGNACWCKNLPDKVPIRIPGECR

    • Sequence Length

    • 64

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03697 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03697.

Physicochemical Information

    • Formula

    • C311H470N92O93S8

    • Absent Amino Acids

    • HM

    • Common Amino Acids

    • C

    • Mass

    • 7242.19

    • PI

    • 8.19

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +2

    • Boman Index

    • -140.23

    • Hydrophobicity

    • -0.608

    • Aliphatic Index

    • 48.91

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17460

    • Absorbance 280nm

    • 277.14

    • Polar Residues

    • 26

DRAMP03697

DRAMP03697 chydropathy plot

Comments Information

    • Function

    • Inhibits Nav1.4 and DmNav1 sodium channels. Has antibacterial activity.

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Characterization of a sodium channel toxin from the scorpion Mesobuthus eupeus venom.

    • Reference

    • Submitted (NOV-2009) to UniProtKB

    • Author

    • Zhu S.Y, Gao B.