• DRAMP ID

    • DRAMP03699
    • Peptide Name

    • Neurotoxin MeuNaTx-6 (Arthropods, animals)
    • Source

    • Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus)
    • Family

    • Belongs to the Sodium channel inhibitor family (Alpha subfamily)
    • Gene

    • Not found
    • Sequence

    • DNGYLLDKYTGCKVWCVINNESCNSECKIRRGNYGYCYFWKLACYCEGAPKSELWHYETNKCNGRM
    • Sequence Length

    • 66
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C341H503N93O100S9
    • Absent Amino Acids

    • Q
    • Common Amino Acids

    • CNY
    • Mass

    • 7793.85
    • PI

    • 8.16
    • Basic Residues

    • 10
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +3
    • Boman Index

    • -127.59
    • Hydrophobicity

    • -0.724
    • Aliphatic Index

    • 47.27
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 27430
    • Absorbance 280nm

    • 422
    • Polar Residues

    • 33

DRAMP03699

DRAMP03699 chydropathy plot
    • Function

    • Inhibits sodium channels (Nav). Has antimicrobial activity.
    • Tissue specificity

    • Expressed by the venom gland.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Characterization of a sodium channel toxin from the scorpion Mesobuthus eupeus venom.
    • Reference

    • Submitted (NOV-2009) to UniProtKB
    • Author

    • Zhu S.Y, Gao B.